Name Beta – Amyloid (1 – 55),Human
Synonyms or Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK Molecular Formula Molecular Weight CAS Number(Or APNoke Number for Non-CAS Products) PNA-2223 Appearance White or off-white lyophilized powder
Identification MS ,
HPLC Storage -20 degrees Celsius away from light
Apnoke Link This product is developed by our
RD company Apnoke Scientific Ltd (
http://apnoke.com/ ), Expert in Amino Acids and Peptides and here is the corresponding link in Apnoke
http://apnoke.com/Beta — Amyloid-(1 — 55),Human-cas-PNA-2223 Quick Inquiry Fill out our inquiry form and one of our experts will be in touch with you shortly (Please change screen to horizontal for complete browsing if you are checking Watson on your mobile phone).