Recombinant Human Fibroblast Growth Factor 21 (rHuFGF-21) CAS 104-21-1816
Official Full Name
Recombinant Human Fibroblast Growth Factor 21 (rHuFGF-21)
CAS Number (Or Watson Number for Non-CAS Products)
104-21-1816
Synonyms
Squence
Amino Acid Sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYA S
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ug/ml, corresponding to a specific activity of > 2.0 × 103 IU/mg in the presence of 5 ug/ml of rMuKlotho-beta and 10 ug/ml of heparin.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Endotoxin
Less than 1 EU/ug of rHuFGF-21 as determined by LAL method.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Stability and Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.