Beta – Amyloid (4 – 40),Human CAS PNA-2282
Beta – Amyloid (4 – 40),Human,PNA-2282,FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV,
Read morePeptides
Beta – Amyloid (29 – 40),Human, mouse/rat CAS PNA-2283
Beta – Amyloid (29 – 40),Human, mouse/rat,PNA-2283,GAIIGLMVGGVV,
Read moreBeta – Amyloid (17 – 40),Human, mouse/rat CAS PNA-2284
Beta – Amyloid (17 – 40),Human, mouse/rat,PNA-2284,LVFFAEDVGSNKGAIIGLMVGGVV,
Read more[Pyr3] – beta – Amyloid (3 – 40),Human CAS PNA-2285
[Pyr3] – beta – Amyloid (3 – 40),Human,PNA-2285,Pyr – FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV,
Read more[Pyr11] – beta – Amyloid (11 – 40),Human CAS PNA-2286
[Pyr11] – beta – Amyloid (11 – 40),Human,PNA-2286,Pyr – VHHQKLVFFAEDVGSNKGAIIGLMVGGVV,
Read moreBeta – Amyloid (5 – 40),Human CAS PNA-2287
Beta – Amyloid (5 – 40),Human,PNA-2287,RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV,
Read moreBeta – Amyloid (8 – 40),Human CAS PNA-2288
Beta – Amyloid (8 – 40),Human,PNA-2288,SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV,
Read moreBeta – Amyloid (40 – 1),Human CAS PNA-2289
Beta – Amyloid (40 – 1),Human,PNA-2289,VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD,
Read more
Beta – Amyloid (1 – 28),Human CAS PNA-2290
Beta – Amyloid (1 – 28),Human,PNA-2290,DAEFRHDSGYEVHHQKLVFFAEDVGSNK,
Read moreBeta – Amyloid (1 – 28) – Lys(Biotin) – NH2,Human CAS PNA-2291
Beta – Amyloid (1 – 28) – Lys(Biotin) – NH2,Human,PNA-2291,DAEFRHDSGYEVHHQKLVFFAEDVGSNK – K(Biotin) – NH2,
Read moreBeta – Amyloid (1 – 28) – Lys(HiLyte Fluor 488), Human CAS PNA-2292
Beta – Amyloid (1 – 28) – Lys(HiLyte Fluor 488), Human,PNA-2292,DAEFRHDSGYEVHHQKLVFFAEDVGSNK – K(HiLyte Fluor 488),
Read moreBeta – Amyloid (11 – 28) – Lys(Biotin) – NH2,Human CAS PNA-2293
Beta – Amyloid (11 – 28) – Lys(Biotin) – NH2,Human,PNA-2293,EVHHQKLVFFAEDVGSNK – K(Biotin) – NH2,
Read moreBeta – Amyloid (12 – 28),Human CAS PNA-2294
Beta – Amyloid (12 – 28),Human,PNA-2294,VHHQKLVFFAEDVGSNK,
Read more[Pro18] – Beta – Amyloid (12 – 28); V8P Beta – Amyloid (12 – 28); ABeta12 – 28P,Human CAS PNA-2295
[Pro18] – Beta – Amyloid (12 – 28); V8P Beta – Amyloid (12 – 28); ABeta12 – 28P,Human,PNA-2295,VHHQKLPFFAEDVGSNK,
Read moreCys – beta – Amyloid (12 – 28),Human CAS PNA-2296
Cys – beta – Amyloid (12 – 28),Human,PNA-2296,CVHHQKLVFFAEDVGSNK,
Read more
New Products
- Palladium/carbon CAS 7440-05-3Palladium,7440-05-3,Palladium on activated carbon,Pd […]
- Recombinant Protein A CAS 91932-65-9Identification […]
- TEMABF4+ACN CAS 69444-47-9[E3C1N]BF4,69444-47-9,TriEthylMethylAmmonium tetraFluoroBorate […]
- 7-bromo-benzo[c][1,2,5]thiadiazole-4-carbaldehyde CAS 1071224-34-47-bromo-benzo[c][1,2,5]thiadiazole-4-carbaldehyde,1071224-34-4,7-Bromo-4-formyl-2,1,3-benzothiadiazole;7-Bromo-2,1,3-benzothiadiazole-4-carboxaldehyde >=97%;2,1,3-Benzothiadiazole-4-carboxaldehyde, 7-bromo-;7-BROMOBENZO[1,25]THIOADIAZOLE-4-CARBALDEHYDE;7-bromo-benzo[c][1,2,5]thiadiazole-4-carbaldehyde;7-Bromo-2,1,3-benzothiadiazole-4-carbaldehyde;7-Bromo-2,1,3-benzothiadiazole-4-carboxaldehyde […]
- Losartan Potassium CAS 124750-99-8Losartan Potassium,124750-99-8,2-Butyl-4-chloro-1-[[2'-(1H-tetrazol-5-yl)[1,1'-biphenyl]-4-yl]methyl]-1H-imidazole-5-methanol monopotassium salt […]
- 4-hydroxymethyl-5-methyl-1,3-dioxol-2-one CAS 91526-18-04-hydroxymethyl-5-methyl-1,3-dioxol-2-one,91526-18-0,,C5H6O4 […]
- 3,4-Dihydroxyacetophenone CAS 1197-09-7Identification […]
- DBzA CAS 850018-19-8850018-19-8,DBzA,6-Methyl-2-(4-(9-(4-(6-methylbenzo[d]thiazol-2-yl)phenyl)anthracen-10-yl)phenyl)benzo[d]thiazole […]
- Racecadotril CAS 81110-73-8Racecadotril,81110-73-8,,C21H23NO4S […]
- Recombinant Arginine Deiminase CAS UENA-0222Identification […]
![Structure of 7-bromo-benzo[c][1,2,5]thiadiazole-4-carbaldehyde CAS 1071224-34-4](https://www.watson-int.com/wp-content/uploads/2018/06/Structure-of-7-bromo-benzoc125thiadiazole-4-carbaldehyde-CAS-1071224-34-4.jpg "Structure of 7-bromo-benzo[c][1,2,5]thiadiazole-4-carbaldehyde <span class=\"caps\">CAS</span> 1071224-34-4")
© 2026 WATSON INTERNATIONAL LIMITED. All Rights Reserved. This site and all content are protected by international Copyright laws. Third party logos and marks appearing on this website are trademarks and/or registered trademarks of their respective owners and licensors, and all rights therein and thereto are reserved to such entities.